Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Target-Kategorie:
KIF5B
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 2 ug/ml.
Human Liver
KIF5B was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574872 with 1:200 dilution. Western blot was performed using orb574872 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIF5B IP with orb574872 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.