KIF5B Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KIF5B Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574872
• Hersteller Artikelnummer: orb574872
• Alternativnummer: BYT-ORB574872-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
• Konjugation: Unconjugated
• Alternative Synonym: KNS, KINH, KNS1, UKHC, HEL-S-61

Produktbeschreibung

Rabbit polyclonal antibody to KIF5B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 110kDa
• NCBI: 004512
• UniProt: P33176
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
• Target-Kategorie: KIF5B

Bilder

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 2 ug/ml.

Human Liver

KIF5B was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574872 with 1:200 dilution. Western blot was performed using orb574872 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIF5B IP with orb574872 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-KIF5B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.