ENO1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB575056
| Artikelname: |
ENO1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB575056 |
| Hersteller Artikelnummer: |
orb575056 |
| Alternativnummer: |
BYT-ORB575056-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ENO1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NNE, PPH, MPB1, ENO1L1, HEL-S-17 |
| Rabbit polyclonal antibody to ENO1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
47kDa |
| NCBI: |
001419 |
| UniProt: |
Q53HR3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
| Target-Kategorie: |
ENO1 |
![]()
|
Human kidney |
![]()
|
Rabbit Anti-ENO1 Antibody, Catalog Number: orb575056, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-ENO1 Antibody, Paraffin Embedded Tissue: Human placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
![]()
|
WB Suggested Anti-ENO1 Antibody Titration: 0.03 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine. |
![]()
|
WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human heart. |
![]()
|
WB Suggested Anti-ENO1 antibody Titration: 1 ug/ml, Sample Type: Human liver. |
