KCNK9 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KCNK9 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB575424
• Hersteller Artikelnummer: orb575424
• Alternativnummer: BYT-ORB575424-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK9
• Konjugation: Unconjugated
• Alternative Synonym: KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32

Produktbeschreibung

Rabbit polyclonal antibody to KCNK9

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 42 kDa
• NCBI: 057685
• UniProt: Q9NPC2
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
• Target-Kategorie: KCNK9

Bilder

orb575424

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody (orb575424).

Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody (orb575424).

WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.