MLXIP Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: MLXIP Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB575688
• Hersteller Artikelnummer: orb575688
• Alternativnummer: BYT-ORB575688-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MLXIP
• Konjugation: Unconjugated
• Alternative Synonym: MIR, MONDOA, bHLHe36

Produktbeschreibung

Rabbit polyclonal antibody to MLXIP

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 101kDa
• NCBI: 055753
• UniProt: Q9HAP2
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP
• Target-Kategorie: MLXIP

Bilder

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/ml. MLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3.

Rabbit Anti-MLXIP Antibody, Catalog Number: orb575688, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. MLXIP is supported by BioGPS gene expression data to be expressed in PANC1.