STAT3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576591
- Bilder (8)
| Artikelname: | STAT3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576591 |
| Hersteller Artikelnummer: | orb576591 |
| Alternativnummer: | BYT-ORB576591-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IF, IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APRF, HIES, ADMIO, ADMIO1 |
| Rabbit polyclonal antibody to STAT3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 88 kDa |
| NCBI: | 003141 |
| UniProt: | B5BTZ6 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES |
| Target-Kategorie: | STAT3 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The immunizing peptide Is present in multiple isoforms from 83-88 kDa, as well as contained within a 49 kDa smaller i. |
|
|
Positive control (+): A549 (N03), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml. |
|
|
Immunofluorescence - Sample Type: Macrophages, Dilution: 1:1000. |
|
|
Immunohistochemistry with Human kidney lysate tissue. |
|
|
Immunohistochemistry with human prostate tissue tissue. |
|
|
Immunohistochemistry with Human Uterus lysate tissue. |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown. |
|
|
WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver. |
Produktgarantie und fachkundiger Support
