PDLIM5 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PDLIM5 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB576835
• Hersteller Artikelnummer: orb576835
• Alternativnummer: BYT-ORB576835-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM5
• Konjugation: Unconjugated
• Alternative Synonym: L9, ENH, LIM, ENH1

Produktbeschreibung

Rabbit polyclonal antibody to PDLIM5

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 64kDa
• NCBI: 006448
• UniProt: Q96HC4
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL
• Target-Kategorie: PDLIM5

Bilder

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.