SSB Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SSB Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB577599
• Hersteller Artikelnummer: orb577599
• Alternativnummer: BYT-ORB577599-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SSB
• Konjugation: Unconjugated
• Alternative Synonym: La, LARP3, La/SSB

Produktbeschreibung

Rabbit polyclonal antibody to SSB

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 45kDa
• NCBI: 003133
• UniProt: P05455
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL
• Target-Kategorie: SSB

Bilder

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SSB antibody (orb577599).

nti-SSB antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-SSB Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SSB Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SSB Antibody Titration: 0.25 ug/ml, Positive Control: Jurkat cell lysate. SSB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.