SLC12A1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SLC12A1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578031
• Hersteller Artikelnummer: orb578031
• Alternativnummer: BYT-ORB578031-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
• Konjugation: Unconjugated
• Alternative Synonym: BSC1, NKCC2

Produktbeschreibung

Rabbit polyclonal antibody to SLC12A1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 47kDa
• NCBI: 40138
• UniProt: Q8IUN5
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
• Target-Kategorie: SLC12A1

Bilder

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in multiple isoforms including 46 kDa.

Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

Rabbit Anti-SLC12A1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.