CYP1A1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: CYP1A1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578043
• Hersteller Artikelnummer: orb578043
• Alternativnummer: BYT-ORB578043-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
• Konjugation: Unconjugated
• Alternative Synonym: AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX

Produktbeschreibung

Rabbit polyclonal antibody to CYP1A1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 58 kDa
• NCBI: 000490
• UniProt: P04798
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
• Target-Kategorie: CYP1A1

Bilder

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Liver Tumor, Antibody Dilution: 1 ug/ml.

Sample Type: Human Kidney, Dilution: 1:100.

WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.