SFTPB Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SFTPB Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578047
• Hersteller Artikelnummer: orb578047
• Alternativnummer: BYT-ORB578047-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFTPB
• Konjugation: Unconjugated
• Alternative Synonym: SP-B, PSP-B, SFTB3, SFTP3, SMDP1

Produktbeschreibung

Rabbit polyclonal antibody to SFTPB

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 42 kDa
• NCBI: 000533
• UniProt: P07988
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
• Target-Kategorie: SFTPB

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. Protein is glycosylated, and processed to yield a propeptide and a mature chain.

25 ug of the indicated Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. Protein is glycosylated.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

SFTPB antibody - middle region (orb578047), Catalog Number: orb578047, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SFTPB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.