Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
Target-Kategorie:
FOLR1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. FOLR1 is modified via glycosylation and processed to a mature form.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 5 ug/ml.
Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane in bile ducts not in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FOLR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. FOLR1 is supported by BioGPS gene expression data to be expressed in PANC1.
