DLAT Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DLAT Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578300
• Hersteller Artikelnummer: orb578300
• Alternativnummer: BYT-ORB578300-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLAT
• Konjugation: Unconjugated
• Alternative Synonym: E2, PBC, DLTA, PDCE2, PDC-E2

Produktbeschreibung

Rabbit polyclonal antibody to DLAT

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 69 kDa
• NCBI: 001922
• UniProt: P10515
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
• Target-Kategorie: DLAT

Bilder

Sample Type: Huh7 lysate (50 ug), Primary Antibody Dilution: 1:200.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms are present from ~68 kDa to ~ 55 kDa.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Rabbit Anti-DLAT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-DLAT Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.