IL18RAP Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578359
| Artikelname: |
IL18RAP Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB578359 |
| Hersteller Artikelnummer: |
orb578359 |
| Alternativnummer: |
BYT-ORB578359-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human IL18RAP |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ACPL, CD218b, IL-1R7, IL18RB, CDw218b, IL-1R-7, IL-18RAcP, IL-1RAcPL, IL-18Rbeta, IL-18R-beta |
| Rabbit polyclonal antibody to IL18RAP |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
66kDa |
| NCBI: |
003844 |
| UniProt: |
O95256 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC |
| Target-Kategorie: |
IL18RAP |
