Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Target-Kategorie:
DMBT1
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human Human Stomach, Antibody Dilution: 1 ug/ml.
Positive control (+): Human Lung (LU), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.
Lanes: Lane 1: 2 ug MCF7-DMBT1+Dox, Lane 2: 2 ug MCF7-DMBT1 -Dox, Lane 3: 2 ug MCF7-Ctrl+Dox, Lane 4: 2 ug MCF7-DMBT1-Dox, Primary Antibody Dilution: 1:5000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: DMBT1.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
