SLC27A2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578965
- Bilder (9)
| Artikelname: | SLC27A2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB578965 |
| Hersteller Artikelnummer: | orb578965 |
| Alternativnummer: | BYT-ORB578965-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | VLCS, FATP2, VLACS, ACSVL1, FACVL1, hFACVL1, HsT17226 |
| Rabbit polyclonal antibody to SLC27A2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 70 kDa |
| NCBI: | 003636 |
| UniProt: | O14975 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
| Target-Kategorie: | SLC27A2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples. |
|
|
Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells. |
|
|
Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml. |
|
|
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE). |
|
|
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE). |
|
|
WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate. |
|
|
WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Jurkat lysate. |
|
|
WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human MCF7. |
|
|
WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human PANC1. |
Produktgarantie und fachkundiger Support
