SGCE Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SGCE Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB579773
• Hersteller Artikelnummer: orb579773
• Alternativnummer: BYT-ORB579773-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGCE
• Konjugation: Unconjugated
• Alternative Synonym: ESG, DYT11, epsilon-SG

Produktbeschreibung

Rabbit polyclonal antibody to SGCE

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 50 kDa
• NCBI: 001092871
• UniProt: B5MDA7
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
• Target-Kategorie: SGCE

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SGCE is supported by BioGPS gene expression data to be expressed in 721_B.

Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Immunohistochemistry with cerebellum tissue.

Immunohistochemistry with pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody (orb579773).

WB Suggested Anti-SGCE Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. SGCE is supported by BioGPS gene expression data to be expressed in 721_B.