GATM Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: GATM Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB580442
• Hersteller Artikelnummer: orb580442
• Alternativnummer: BYT-ORB580442-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GATM
• Konjugation: Unconjugated
• Alternative Synonym: AT, AGAT, CCDS3, FRTS1

Produktbeschreibung

Rabbit polyclonal antibody to GATM

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 48 kDa
• NCBI: 001473
• UniProt: P50440
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
• Target-Kategorie: GATM

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Rabbit Anti-GATM antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GATM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. GATM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.