CTBP2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: CTBP2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB581169
• Hersteller Artikelnummer: orb581169
• Alternativnummer: BYT-ORB581169-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP2
• Konjugation: Unconjugated

Produktbeschreibung

Rabbit polyclonal antibody to CTBP2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 106kDa
• NCBI: 073713
• UniProt: P56545
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA
• Target-Kategorie: CTBP2

Bilder

Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CTBP2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. CTBP2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.