GP1BA Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: GP1BA Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB581343
• Hersteller Artikelnummer: orb581343
• Alternativnummer: BYT-ORB581343-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
• Konjugation: Unconjugated
• Alternative Synonym: BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha

Produktbeschreibung

Rabbit polyclonal antibody to GP1BA

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 72 kDa
• NCBI: 000164
• UniProt: P07359
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
• Target-Kategorie: GP1BA

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GP1BA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.