Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Target-Kategorie:
GP1BA
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.