PPP3CA Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PPP3CA Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB581356
• Hersteller Artikelnummer: orb581356
• Alternativnummer: BYT-ORB581356-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP3CA
• Konjugation: Unconjugated
• Alternative Synonym: CALN, CCN1, CNA1, CALNA, DEE91, IECEE, PPP2B, ACCIID, CALNA1, IECEE1

Produktbeschreibung

Rabbit polyclonal antibody to PPP3CA

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 59kDa
• NCBI: 000935
• UniProt: Q08209
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
• Target-Kategorie: PPP3CA

Bilder

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.