Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reinheit:
Affinity Purified
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
Target-Kategorie:
ACE2
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Lane 1: 50 ug rat liver lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:2000, Gene Name: ACE2.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
