ALAS1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: ALAS1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB582296
• Hersteller Artikelnummer: orb582296
• Alternativnummer: BYT-ORB582296-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALAS1
• Konjugation: Unconjugated
• Alternative Synonym: ALAS, MIG4, ALAS3, ALASH, ALAS-H

Produktbeschreibung

Rabbit polyclonal antibody to ALAS1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 71 kDa
• NCBI: 000679
• UniProt: P13196
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
• Target-Kategorie: ALAS1

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): HepG2 (HG), Antibody concentration: 0.5 ug/ml.

Rabbit Anti-ALAS1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ALAS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.