CCDC7 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB582343
| Artikelname: |
CCDC7 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB582343 |
| Hersteller Artikelnummer: |
orb582343 |
| Alternativnummer: |
BYT-ORB582343-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Animal, Bovine, Human, Mouse, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC7 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
BioT2-A, BioT2-B, BioT2-C, RP11-479G22.1 |
| Rabbit polyclonal antibody to CCDC7 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
56kDa |
| NCBI: |
001021554 |
| UniProt: |
Q96M83 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI |
| Target-Kategorie: |
CCDC7 |
