LDHA Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB582473
Artikelname: LDHA Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB582473
Hersteller Artikelnummer: orb582473
Alternativnummer: BYT-ORB582473-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Konjugation: Unconjugated
Alternative Synonym: LDHM, GSD11, PIG19, HEL-S-133P
Rabbit polyclonal antibody to LDHA
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 37 kDa
NCBI: 005557
UniProt: P00338
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Target-Kategorie: LDHA
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms of ~35 kDa and 30 kDa also contain the peptide.
Anti-LDHA antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. LDHA Antibody concentration 2.5 ug/ml.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
LDHA antibody - N-terminal region (orb582473) validated by WB using LdhC knockout mouse sperm, LdhA transgenic kidney, IdhA transgenic testis, LdhC knockout testis at 1:1000.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.