PDIA3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: PDIA3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB585694
• Hersteller Artikelnummer: orb585694
• Alternativnummer: BYT-ORB585694-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, IP, WB
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: P58, ER60, ERp57, ERp60, ERp61, GRP57, GRP58, PI-PLC, HsT17083, HEL-S-269, HEL-S-93n

Produktbeschreibung

Rabbit polyclonal antibody to PDIA3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 56kDa
• NCBI: 005304
• UniProt: P30101
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE
• Target-Kategorie: PDIA3

Bilder

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA3, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA3.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PDIA3 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

IP Suggested Anti-PDIA3 Antibody Positive Control: NT2 CELL/BRAIN TISSUE.

PDIA3 antibody - C-terminal region (orb585694) validated by WB using Fetal Kidney Lysate at 1.0 ug/ml.

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PDIA3: Red DAPI:Blue, Gene Name: PDIA3.