Rat Artn protein

Artikelnummer: BYT-ORB603920
Artikelname: Rat Artn protein
Artikelnummer: BYT-ORB603920
Hersteller Artikelnummer: orb603920
Alternativnummer: BYT-ORB603920-1,BYT-ORB603920-100,BYT-ORB603920-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ArtnArtemin
This Rat Artn protein spans the amino acid sequence from region 112-224aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 17.1 kDa
UniProt: Q6AYE8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Artn.