Human CYP11B1 protein

Artikelnummer: BYT-ORB604029
Artikelname: Human CYP11B1 protein
Artikelnummer: BYT-ORB604029
Hersteller Artikelnummer: orb604029
Alternativnummer: BYT-ORB604029-1,BYT-ORB604029-100,BYT-ORB604029-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CYP11B1, S11BHCytochrome P450 11B1, mitochondrial, CYPXIB1, Cytochrome P-450c11, Cytochrome P450C11, Steroid 11-beta-hydroxylase, CYP11B1, EC 1.14.15.4
This Human CYP11B1 protein spans the amino acid sequence from region 25-503aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 74.9 kDa
UniProt: P15538
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYP11B1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYP11B1.