Bovine FDX1 protein

Produktübersicht

• Artikelname: Bovine FDX1 protein
• Artikelnummer: BYT-ORB604086
• Hersteller Artikelnummer: orb604086
• Alternativnummer: BYT-ORB604086-1,BYT-ORB604086-100,BYT-ORB604086-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

Produktbeschreibung

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 19.5 kDa
• UniProt: P00257
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bos taurus (Bovine)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) FDX1.