Rat Galectin 3 protein

Produktübersicht

• Artikelname: Rat Galectin 3 protein
• Artikelnummer: BYT-ORB604225
• Hersteller Artikelnummer: orb604225
• Alternativnummer: BYT-ORB604225-1,BYT-ORB604225-100,BYT-ORB604225-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 35KDA lectin Carbohydrate-binding protein 35

Produktbeschreibung

This Rat Galectin 3 protein spans the amino acid sequence from region 2-262aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 31.1 kDa
• UniProt: P08699
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rattus norvegicus (Rat)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals3.