Bacteria Lachnospiraceae bacterium A4 Flagellin protein

Artikelnummer: BYT-ORB604469
Artikelname: Bacteria Lachnospiraceae bacterium A4 Flagellin protein
Artikelnummer: BYT-ORB604469
Hersteller Artikelnummer: orb604469
Alternativnummer: BYT-ORB604469-20,BYT-ORB604469-100,BYT-ORB604469-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Bacteria Lachnospiraceae bacterium A4 Flagellin protein spans the amino acid sequence from region 1-520aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 56.2 kDa
UniProt: A7IZG7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lachnospiraceae bacterium A4
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SGSTEKLSSGYRVNRAADDAAGLAISEKMRKQIRGLTQGSRNAEDGISCVQTAEGALAEVQDMLQRMNELAVQATNGTNSVTDRKYIQDEIDQLVTEIDRVSETTKFNETYLLKGDEELPENLVHTFNYAKGDKIDQLGTSSVLNAKSDRVMVNYNGVDNVYVVSASISSAGSKESMTADVKTKGSDFTKYLASGEVGTSSSVTSVAMSTSYAMFKNTNLNGVALQKMANGTVYADKDAYIYDTETKNIIHIKAT
Anwendungsbeschreibung: Biological Origin: Lachnospiraceae bacterium A4. Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lachnospiraceae bacterium A4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lachnospiraceae bacterium A4.