Bacteria Lachnospiraceae bacterium A4 Flagellin protein

Produktübersicht

• Artikelname: Bacteria Lachnospiraceae bacterium A4 Flagellin protein
• Artikelnummer: BYT-ORB604469
• Hersteller Artikelnummer: orb604469
• Alternativnummer: BYT-ORB604469-20,BYT-ORB604469-100,BYT-ORB604469-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produktbeschreibung

This Bacteria Lachnospiraceae bacterium A4 Flagellin protein spans the amino acid sequence from region 1-520aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.2 kDa
• UniProt: A7IZG7
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Lachnospiraceae bacterium A4
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SGSTEKLSSGYRVNRAADDAAGLAISEKMRKQIRGLTQGSRNAEDGISCVQTAEGALAEVQDMLQRMNELAVQATNGTNSVTDRKYIQDEIDQLVTEIDRVSETTKFNETYLLKGDEELPENLVHTFNYAKGDKIDQLGTSSVLNAKSDRVMVNYNGVDNVYVVSASISSAGSKESMTADVKTKGSDFTKYLASGEVGTSSSVTSVAMSTSYAMFKNTNLNGVALQKMANGTVYADKDAYIYDTETKNIIHIKAT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Lachnospiraceae bacterium A4. Application Notes: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lachnospiraceae bacterium A4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lachnospiraceae bacterium A4.