Parasite LDBPK_361420 protein

Produktübersicht

• Artikelname: Parasite LDBPK_361420 protein
• Artikelnummer: BYT-ORB604479
• Hersteller Artikelnummer: orb604479
• Alternativnummer: BYT-ORB604479-20,BYT-ORB604479-100,BYT-ORB604479-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produktbeschreibung

This Parasite LDBPK_361420 protein spans the amino acid sequence from region 15-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 13.7 kDa
• UniProt: E9BTK1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Leishmania donovani (strain BPK282A1)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Leishmania donovani (strain BPK282A1). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Leishmania donovani (strain BPK282A1) LDBPK_361420.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Leishmania donovani (strain BPK282A1) LDBPK_361420.