Virus L protein

Produktübersicht

• Artikelname: Virus L protein
• Artikelnummer: BYT-ORB604544
• Hersteller Artikelnummer: orb604544
• Alternativnummer: BYT-ORB604544-20,BYT-ORB604544-100,BYT-ORB604544-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Large structural protein Replicase Transcriptase

Produktbeschreibung

This Virus L protein spans the amino acid sequence from region 625-809aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 24.9 kDa
• UniProt: Q05318
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.