Virus L protein

Artikelnummer: BYT-ORB604544
Artikelname: Virus L protein
Artikelnummer: BYT-ORB604544
Hersteller Artikelnummer: orb604544
Alternativnummer: BYT-ORB604544-20,BYT-ORB604544-100,BYT-ORB604544-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Large structural protein Replicase Transcriptase
This Virus L protein spans the amino acid sequence from region 625-809aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 24.9 kDa
UniProt: Q05318
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG
Anwendungsbeschreibung: Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.