Plant Abrus precatorius Abrin-a protein

Produktübersicht

• Artikelname: Plant Abrus precatorius Abrin-a protein
• Artikelnummer: BYT-ORB604577
• Hersteller Artikelnummer: orb604577
• Alternativnummer: BYT-ORB604577-20,BYT-ORB604577-100,BYT-ORB604577-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: rRNA N-glycosidase

Produktbeschreibung

This Plant Abrus precatorius Abrin-a protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.6 kDa
• UniProt: P11140
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Abrus precatorius (Indian licorice) (Glycine abrus)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Abrus precatorius (Indian licorice) (Glycine abrus). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus).