Plant Abrus precatorius Abrin-a protein
Artikelnummer:
BYT-ORB604577
- Bilder (3)
| Artikelname: | Plant Abrus precatorius Abrin-a protein |
| Artikelnummer: | BYT-ORB604577 |
| Hersteller Artikelnummer: | orb604577 |
| Alternativnummer: | BYT-ORB604577-20,BYT-ORB604577-100,BYT-ORB604577-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | rRNA N-glycosidase |
| This Plant Abrus precatorius Abrin-a protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 33.6 kDa |
| UniProt: | P11140 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Abrus precatorius (Indian licorice) (Glycine abrus) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN |
| Anwendungsbeschreibung: | Biological Origin: Abrus precatorius (Indian licorice) (Glycine abrus). Application Notes: Partial |



