Plant Phytophthora cryptogea Beta-elicitin cryptogein protein

Artikelnummer: BYT-ORB604598
Artikelname: Plant Phytophthora cryptogea Beta-elicitin cryptogein protein
Artikelnummer: BYT-ORB604598
Hersteller Artikelnummer: orb604598
Alternativnummer: BYT-ORB604598-20,BYT-ORB604598-100,BYT-ORB604598-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CRY
This Plant Phytophthora cryptogea Beta-elicitin cryptogein protein spans the amino acid sequence from region 21-118aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 17.3 kDa
UniProt: P15570
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Phytophthora cryptogea
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL
Anwendungsbeschreibung: Biological Origin: Phytophthora cryptogea. Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phytophthora cryptogea.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phytophthora cryptogea.