Plant Phytophthora cryptogea Beta-elicitin cryptogein protein

Produktübersicht

• Artikelname: Plant Phytophthora cryptogea Beta-elicitin cryptogein protein
• Artikelnummer: BYT-ORB604598
• Hersteller Artikelnummer: orb604598
• Alternativnummer: BYT-ORB604598-20,BYT-ORB604598-100,BYT-ORB604598-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CRY

Produktbeschreibung

This Plant Phytophthora cryptogea Beta-elicitin cryptogein protein spans the amino acid sequence from region 21-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 17.3 kDa
• UniProt: P15570
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Phytophthora cryptogea
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Phytophthora cryptogea. Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phytophthora cryptogea.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phytophthora cryptogea.