Plant XERO2 protein

Artikelnummer: BYT-ORB604637
Artikelname: Plant XERO2 protein
Artikelnummer: BYT-ORB604637
Hersteller Artikelnummer: orb604637
Alternativnummer: BYT-ORB604637-20,BYT-ORB604637-100,BYT-ORB604637-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Low-temperature-induced protein LTI30 (LTI30)
This Plant XERO2 protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 28.4 kDa
UniProt: P42758
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNSHQNQTGVQKKGITEKIMEKLPGHHGPTNTGVVHHEKKGMTEKVMEQLPGHHGATGTGGVHHEKKGMTEKVMEQLPGHHGSHQTGTNTTYGTTNTGGVHHEKKSVTEKVMEKLPGHHGSHQTGTNTAYGTNTNVVHHEKKGIAEKIKEQLPGHHGTHKTGTTTSYGNTGVVHHENKSTMDKIKEKLPGGHH
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Arabidopsis thaliana (Mouse-ear cress) XERO2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Arabidopsis thaliana (Mouse-ear cress) XERO2.