Virus US12 protein

Produktübersicht

• Artikelname: Virus US12 protein
• Artikelnummer: BYT-ORB604710
• Hersteller Artikelnummer: orb604710
• Alternativnummer: BYT-ORB604710-20,BYT-ORB604710-100,BYT-ORB604710-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)

Produktbeschreibung

This Virus US12 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 23.9 kDa
• UniProt: P60504
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Herpes simplex virus type 2 (strain SA8) (Simian agent 8)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Herpes simplex virus type 2 (strain SA8) (Simian agent 8). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.