Reptile TLF1 protein

Artikelnummer: BYT-ORB604721
Artikelname: Reptile TLF1 protein
Artikelnummer: BYT-ORB604721
Hersteller Artikelnummer: orb604721
Alternativnummer: BYT-ORB604721-20,BYT-ORB604721-100,BYT-ORB604721-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)
This Reptile TLF1 protein spans the amino acid sequence from region 25-260aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 33.1 kDa
UniProt: P05620
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP
Anwendungsbeschreibung: Biological Origin: Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.