Virus E4 protein

Artikelnummer: BYT-ORB604722
Artikelname: Virus E4 protein
Artikelnummer: BYT-ORB604722
Hersteller Artikelnummer: orb604722
Alternativnummer: BYT-ORB604722-20,BYT-ORB604722-100,BYT-ORB604722-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: E1 E4
This Virus E4 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 17.5 kDa
UniProt: P06922
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human papillomavirus type 16
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP
Anwendungsbeschreibung: Biological Origin: Human papillomavirus type 16. Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16E4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16E4.