E. coli fimH protein

Artikelnummer: BYT-ORB604781
Artikelname: E. coli fimH protein
Artikelnummer: BYT-ORB604781
Hersteller Artikelnummer: orb604781
Alternativnummer: BYT-ORB604781-20,BYT-ORB604781-100,BYT-ORB604781-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: fimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH
This E. coli fimH protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 33.1 kDa
UniProt: P08191
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTAN
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.