E. coli pal protein

Produktübersicht

• Artikelname: E. coli pal protein
• Artikelnummer: BYT-ORB604795
• Hersteller Artikelnummer: orb604795
• Alternativnummer: BYT-ORB604795-20,BYT-ORB604795-100,BYT-ORB604795-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Tol-Pal system lipoprotein Pal (excC) (PAL)

Produktbeschreibung

This E. coli pal protein spans the amino acid sequence from region 22-173aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 24.1 kDa
• UniProt: P0A912
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli (strain K12)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) pal.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) pal.