Bacteria grxD protein

Artikelnummer: BYT-ORB604800
Artikelname: Bacteria grxD protein
Artikelnummer: BYT-ORB604800
Hersteller Artikelnummer: orb604800
Alternativnummer: BYT-ORB604800-20,BYT-ORB604800-100,BYT-ORB604800-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Monothiol glutaredoxin (ydhD) (Grx4)
This Bacteria grxD protein spans the amino acid sequence from region 1-115aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 28.9 kDa
UniProt: P0AC72
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Shigella flexneri
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Anwendungsbeschreibung: Biological Origin: Shigella flexneri. Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Shigella flexnerigrxD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Shigella flexnerigrxD.