Fungi mas5 protein

Produktübersicht

• Artikelname: Fungi mas5 protein
• Artikelnummer: BYT-ORB604861
• Hersteller Artikelnummer: orb604861
• Alternativnummer: BYT-ORB604861-20,BYT-ORB604861-100,BYT-ORB604861-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: mas5, SPBC1734.11, Mitochondrial protein import protein mas5

Produktbeschreibung

This Fungi mas5 protein spans the amino acid sequence from region 1-404aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 51.5 kDa
• UniProt: O74752
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) mas5.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) mas5.