Plant MPK5 protein

Produktübersicht

• Artikelname: Plant MPK5 protein
• Artikelnummer: BYT-ORB604882
• Hersteller Artikelnummer: orb604882
• Alternativnummer: BYT-ORB604882-20,BYT-ORB604882-100,BYT-ORB604882-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Benzothiadiazole-induced MAP kinase 1 MAP kinase 2 Multiple stress-responsive MAP kinase 2 OsBIMK1 OsMAP1 OsMAPK2 OsMAPK5 OsMPK3 OsMSRMK2 BIMK1, MAPK2, MAPK5, MPK3, MSRMK2

Produktbeschreibung

This Plant MPK5 protein spans the amino acid sequence from region 1-369aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 48 kDa
• UniProt: Q10N20
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Oryza sativa subsp. japonica (Rice)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Oryza sativa subsp. japonica (Rice). Application Notes: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Oryza sativa subsp. japonica (Rice) MPK5.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Oryza sativa subsp. japonica (Rice) MPK5.