Fungi sodC protein

Artikelnummer: BYT-ORB604903
Artikelname: Fungi sodC protein
Artikelnummer: BYT-ORB604903
Hersteller Artikelnummer: orb604903
Alternativnummer: BYT-ORB604903-20,BYT-ORB604903-100,BYT-ORB604903-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: sodC, Superoxide dismutase [Cu-Zn], EC 1.15.1.1, Fragment
This Fungi sodC protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 19.6 kDa
UniProt: Q12548
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Aspergillus japonicus
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NSSSVPLHGFHVHALGDTTNGCMSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHADPDDLGKGGHELSKTTGNSNSSMDSCAHGIQGIL
Anwendungsbeschreibung: Biological Origin: Aspergillus japonicus. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus japonicussodC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus japonicussodC.