Virus LMP1 protein
Artikelnummer:
BYT-ORB604919
- Bilder (3)
| Artikelname: | Virus LMP1 protein |
| Artikelnummer: | BYT-ORB604919 |
| Hersteller Artikelnummer: | orb604919 |
| Alternativnummer: | BYT-ORB604919-20,BYT-ORB604919-100,BYT-ORB604919-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Protein p63 |
| This Virus LMP1 protein spans the amino acid sequence from region 185-371aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 24.3 kDa |
| UniProt: | Q1HVB3 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
| Anwendungsbeschreibung: | Biological Origin: Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4). Application Notes: Partial |



