Mouse Milr1 protein

Artikelnummer: BYT-ORB604933
Artikelname: Mouse Milr1 protein
Artikelnummer: BYT-ORB604933
Hersteller Artikelnummer: orb604933
Alternativnummer: BYT-ORB604933-20,BYT-ORB604933-100,BYT-ORB604933-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergy inhibitory receptor 1 Mast cell antigen 32 Short name, MCA-32 Short name, Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32
This Mouse Milr1 protein spans the amino acid sequence from region 34-150aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 20.1 kDa
UniProt: Q3TB92
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.