Virus BZLF1 protein
Artikelnummer:
BYT-ORB604936
- Bilder (3)
| Artikelname: | Virus BZLF1 protein |
| Artikelnummer: | BYT-ORB604936 |
| Hersteller Artikelnummer: | orb604936 |
| Alternativnummer: | BYT-ORB604936-20,BYT-ORB604936-100,BYT-ORB604936-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Zebra |
| This Virus BZLF1 protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 33.8 kDa |
| UniProt: | Q3KSS8 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF |
| Anwendungsbeschreibung: | Biological Origin: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Application Notes: Full Length |



