Bacteria icaB protein

Artikelnummer: BYT-ORB604995
Artikelname: Bacteria icaB protein
Artikelnummer: BYT-ORB604995
Hersteller Artikelnummer: orb604995
Alternativnummer: BYT-ORB604995-20,BYT-ORB604995-100,BYT-ORB604995-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Biofilm polysaccharide intercellular adhesin deacetylase Short name, Biofilm PIA deacetylase Intercellular adhesion protein B
This Bacteria icaB protein spans the amino acid sequence from region 29-290aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 35.9 kDa
UniProt: Q7A349
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain N315)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRW
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain N315). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.