Virus M protein

Produktübersicht

• Artikelname: Virus M protein
• Artikelnummer: BYT-ORB605005
• Hersteller Artikelnummer: orb605005
• Alternativnummer: BYT-ORB605005-20,BYT-ORB605005-100,BYT-ORB605005-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: M, Matrix protein

Produktbeschreibung

This Virus M protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 35.1 kDa
• UniProt: Q6WB99
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human metapneumovirus (strain CAN97-83) (HMPV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human metapneumovirus (strain CAN97-83) (HMPV). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human metapneumovirus (strain CAN97-83) (HMPV) M.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human metapneumovirus (strain CAN97-83) (HMPV) M.