Bacteria disA protein

Artikelnummer: BYT-ORB605006
Artikelname: Bacteria disA protein
Artikelnummer: BYT-ORB605006
Hersteller Artikelnummer: orb605006
Alternativnummer: BYT-ORB605006-20,BYT-ORB605006-100,BYT-ORB605006-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cyclic di-AMP synthase (c-di-AMP synthase) (Diadenylate cyclase)
This Bacteria disA protein spans the amino acid sequence from region 1-357aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 45.9 kDa
UniProt: Q743W9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTRPTLRETVARLAPGTGLRDGLERILRGRTGALIVLGNDENVEAICDGGFALDVRYAPTRLRELAKMDGAVVLSTDGSRIVRANVQLVPDPSIATDESGTRHRSAERAAIQTGYPVISVSHSMNIVTVYVGGERHVVADSATILSRANQAIATLERYKIRLDEVSRQLSRAEIEDFVTLRDVLTVVQRLELVRRIGQVIDNDVVELGTDGRQLRLQLDELLGGNDNARELIVRDYHASPEQLSEAQMTATLDEL
Anwendungsbeschreibung: Biological Origin: Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) disA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) disA.